PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009597907.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 320aa    MW: 36827.9 Da    PI: 9.9667
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009597907.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.4e-181762147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G+ +W++Ia++++ gR++k+c++rw++ 
   XP_009597907.1 17 RGHWRPAEDERLRQLVEQYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 62
                     899*****************************.***********996 PP

2Myb_DNA-binding61.22.1e-1969113147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r ++T+eE+e+lv a++ +G++ W++I+r ++ gRt++ +k++w+ +
   XP_009597907.1  69 RRPFTEEEEERLVAAHRIHGNK-WALISRLFP-GRTDNAVKNHWHVL 113
                      679*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.0921263IPR017930Myb domain
SuperFamilySSF466891.42E-2915110IPR009057Homeodomain-like
SMARTSM007179.5E-151665IPR001005SANT/Myb domain
PfamPF002491.5E-171762IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-271870IPR009057Homeodomain-like
CDDcd001671.36E-132061No hitNo description
PROSITE profilePS5129428.39964118IPR017930Myb domain
SMARTSM007172.9E-1668116IPR001005SANT/Myb domain
PfamPF002498.8E-1669113IPR001005SANT/Myb domain
CDDcd001672.33E-1271114No hitNo description
Gene3DG3DSA:1.10.10.603.5E-2171117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MAEGGGSGDD TRSSCPRGHW RPAEDERLRQ LVEQYGPQNW NSIAEKLQGR SGKSCRLRWF  60
NQLDPRINRR PFTEEEEERL VAAHRIHGNK WALISRLFPG RTDNAVKNHW HVLMARKQRE  120
QSKNICGKRS YKLQHDNFLS DSKSPSYGFR RRNNDNNNNN PKTQLEGNYG SKISFFEFQN  180
PNKDRVFSLS TYSPELFGRN GSHLFRESSN FSDKKPLCQN NLSFSLCGGY EGTAALGVPN  240
NYKRSNIQNP FSYSVPADHR INVSDGMTEG VVNIRDSTFS LKKMLRANIE QQRRQQQYGE  300
EAREKEDIPF IDFLGVGISS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-31171174104C-Myb DNA-Binding Domain
1msf_C3e-31171174104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597907.10.0PREDICTED: myb-related protein B-like
RefseqXP_016438115.10.0PREDICTED: myb-related protein B-like
TrEMBLK4BT451e-147K4BT45_SOLLC; Uncharacterized protein
STRINGSolyc04g064540.2.11e-147(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.12e-66myb domain protein 52